PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_18710-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 777aa    MW: 84290.2 Da    PI: 4.3332
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_18710-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.41.4e-12181222346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE +ll++a + +Gg+ W+ Ia+++  ++t  qc +++++
  TRIUR3_18710-P1 181 SWTDEETLLLLEALEIFGGK-WTEIAEHVA-TKTKTQCMLHFLQ 222
                      7*******************.*********.**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5093412.129152IPR007526SWIRM domain
SuperFamilySSF466891.25E-5344IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.105.9E-5447IPR011991Winged helix-turn-helix DNA-binding domain
PROSITE profilePS501359.687119165IPR000433Zinc finger, ZZ-type
SMARTSM002912.0E-8119163IPR000433Zinc finger, ZZ-type
SuperFamilySSF578503.06E-11121155No hitNo description
PfamPF005696.4E-8122158IPR000433Zinc finger, ZZ-type
CDDcd023361.06E-20123167No hitNo description
PROSITE patternPS013570125151IPR000433Zinc finger, ZZ-type
PROSITE profilePS5129321.06177228IPR017884SANT domain
SuperFamilySSF466894.49E-13178231IPR009057Homeodomain-like
SMARTSM007172.8E-13178226IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-9179221IPR009057Homeodomain-like
PfamPF002496.5E-12181223IPR001005SANT/Myb domain
CDDcd001670.00271199223No hitNo description
PfamPF164958.5E-21664742IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MMKFHANPQL QLEPKDLAEL SVGEVDARQE VFDFLDHWGL INFHPFPPAG LEESKPEESQ  60
SDSRNEEKAC LIEKLFKFEP VQSYMIPLPN KGEGEIPVPL PTLLPDPVLV EDVIAAAEPS  120
VEYHCNSCSV DCSGKRYHCR TQADFDLCSN CYNEAKFDAG MSKTDFILMD STEVSGARGT  180
SWTDEETLLL LEALEIFGGK WTEIAEHVAT KTKTQCMLHF LQMQIEDRFH DGDDIHQNIH  240
ESTEQALVEK GTPEVPEKME TEEKVEGKDT KDEKPSEKTE GNHTEEKTEE GSVVENKDAK  300
NSGGADSVTT PNVDEPKPSS DTDLAKENSV NLDTSEKNVP DDAIDISGEN ASNDAIDILK  360
SAFEAVGNFP GHEGSFADAG NPVMALAAFL AGLVEDDNAT TSCRSSLKAI SEDSPALQLA  420
SRHCYILEDP PSDLKDIFVT VSNTNKDEDQ AKGEDQAKDE DMVIDSTGTE KKDINGKEEN  480
TVSVEKQNSP SISPKDHKES DTKNVSCDDE APTVKPKSNK AKETDDPIPL VDKSASNDTQ  540
VPSSSTKDSV APENNANGCG LSASQEVVAG STTCATNPEL LKDKPSSEVE PVDDSPSQGK  600
IELNKTEDAV AAPTAVQDEK THTLGNGKLE EPNSAENVPA DGEMVSRVTA EHNDSLTRLK  660
RAAATAVSAA AAKAKLLAEQ EEDQIRRLAA LVVEKLLQKT EAKMSLFADV EHVALRTREY  720
TEKTRKKLLM ERNAIIAARM GALPSRPNQQ GAAGNRLPPG YGAPAVRPPN AMPRPSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3628980.0AK362898.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2010P22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230701.10.0PREDICTED: SWI/SNF complex subunit SWI3D isoform X1
TrEMBLM8AB820.0M8AB82_TRIUA; SWI/SNF complex subunit SWI3D
STRINGMLOC_60197.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45421214